Protein Info for PS417_05295 in Pseudomonas simiae WCS417

Annotation: DeoR faimly transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 778 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 278 to 297 (20 residues), see Phobius details PF00672: HAMP" amino acids 295 to 343 (49 residues), 63.2 bits, see alignment 3.4e-21 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 352 to 495 (144 residues), 72.7 bits, see alignment E=1.5e-24 PF00990: GGDEF" amino acids 356 to 497 (142 residues), 91.7 bits, see alignment E=6.5e-30 PF00563: EAL" amino acids 527 to 761 (235 residues), 239.3 bits, see alignment E=5.7e-75

Best Hits

KEGG orthology group: None (inferred from 93% identity to pfs:PFLU1081)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U5B8 at UniProt or InterPro

Protein Sequence (778 amino acids)

>PS417_05295 DeoR faimly transcriptional regulator (Pseudomonas simiae WCS417)
MRWRHTFQTRIAGVLALLLLVVVAATYFAVKTATTRAVENQARVQLQTGSQVFERLLDLR
GRRLQYGLDWLTVDLPFKHAVAEGKTGPVLAALRRHGTGIRSSEVFVLGLDGKVMVSTLP
IFVRGQSFPYDDALRHARRTGLQMLIVALDGRPYLLVQREVIDDLPIARVVMGFPMDKLF
ASELRSMSNLEVSFLSVQNDTPGPLFSTQPQAYQAGTLSLLREGHVDPEPKIHMFYGQRV
LSLVLPLANTGNGDEVRVLLQSPLDHALESFAPLDRQFLGIALAVLLVSLAAALFLARRV
SRPLNALVQAAERIGAGDYRTPVRVRSHDEFGLLARAFNAMQSGIAVRERQLAHNALHDP
LTGLPNRALAMERLGSAISARRPVVLLYLGIENYRVINEGFGPQGVEEMLREASRCLSIS
LLASDTAARIAGSEFLLLLENTEVDRAVARADRLYALLTEPQRIGNDELRHEVSMGIAAY
PADGQQVEELISRAAIARHDAASLPGHLQIYQQDRDLAHQRQITLIRDLRRAAIEGELFL
CYQPKLDLKHGHVCQAEALLRWQHPTLGQVSPVEFIPLAERTGSMRSLTLWVIEEAIRQI
AEWAQRGMLIQLSVNISVDDLADDDLAIRVTALLMTYQVEAEQLIFEITESAIMHNPLQA
LSVLEQLRGCGISLSVDDFGTGYSSLAQLQRLPVQELKIDQSFVRNLDSTSGDGVIVRST
IEMSHNLGLKVVAEGVEFAPSLKLLKQWNCDTAQGYLISRPLNAMAFEMWMRRERVPL