Protein Info for GFF1042 in Xanthobacter sp. DMC5

Annotation: putative cysteine desulfurase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01979: cysteine desulfurase, SufS family
  • amino acids 17 to 414 (398 residues), 582.2 bits, E=2.6e-179
• PF00266: Aminotran_5
  • amino acids 35 to 403 (369 residues), 486.9 bits, E=9.6e-150
• PF01212: Beta_elim_lyase
  • amino acids 95 to 253 (159 residues), 29.1 bits, E=1.6e-10
• PF01053: Cys_Met_Meta_PP
  • amino acids 96 to 212 (117 residues), 28.2 bits, E=1.9e-10
• PF00155: Aminotran_1_2
  • amino acids 99 to 200 (102 residues), 22.2 bits, E=1.9e-08

Best Hits

Swiss-Prot: 51% identical to SUFS_PECAS: Cysteine desulfurase (sufS) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: None (inferred from 90% identity to xau:Xaut_4466)

MetaCyc: 51% identical to L-cysteine desulfurase (Escherichia coli K-12 substr. MG1655)
Selenocysteine lyase. [EC: 4.4.1.16]; Cysteine desulfurase. [EC: 4.4.1.16, 2.8.1.7]

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7), SufS subfamily" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

• superpathway of L-alanine biosynthesis (4/4 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• L-alanine biosynthesis III (1/1 steps found)
• L-cysteine degradation IV (1/1 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
• cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
• bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (3/6 steps found)
• tRNA-uridine 2-thiolation (thermophilic bacteria) (2/5 steps found)
• tRNA-uridine 2-thiolation (mammalian mitochondria) (1/4 steps found)
• tRNA-uridine 2-thiolation (yeast mitochondria) (1/4 steps found)
• molybdopterin biosynthesis (2/6 steps found)
• tRNA-uridine 2-thiolation (cytoplasmic) (1/8 steps found)
• [2Fe-2S] iron-sulfur cluster biosynthesis (2/10 steps found)
• tRNA-uridine 2-thiolation and selenation (bacteria) (2/11 steps found)

KEGG Metabolic Maps

• Selenoamino acid metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7, 4.4.1.16

Use Curated BLAST to search for 2.8.1.7 or 4.4.1.16

Protein Sequence (415 amino acids)

>GFF1042 putative cysteine desulfurase (Xanthobacter sp. DMC5)
MTKPHPAVADGSFDVERVRADFPALSLEVNGHPLTYLDNAASAQKPRQVIDRMVTAYERE
YSNVHRGLHYLANAATEAFEHARETARAFLNAGSIDEIIFTRSGTGAINTVASSLGQSIE
AGDEIVLSIMEHHSNIVPWHFLRERKGAVIKWAPVREDGSFDLDAFKALLGPRTKIVAIT
HMSNVLGTVTPIKEIAAAAHAVGAKVAVDGCQAIVHMPVDVRDLDVDFYAVTGHKLYAPT
GIGLLYGKKELLEAMPPYEGGGEMIREVTEETVTYGVPPHRFEAGTPPIVQAIGLGAAME
YVQSIGRERIAAHEHDLSAYAHERLRALNSLRIIGTAADKGAIISFEMKGAHPHDVATII
DRYGVAVRAGTHCAQPLLARYGATATCRASFALYNTRADVDRLVDALVKAQDLFA