Protein Info for GFF104 in Variovorax sp. SCN45

Annotation: General secretion pathway protein D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 863 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF21305: type_II_gspD_N0" amino acids 44 to 113 (70 residues), 74.9 bits, see alignment E=5.6e-25 TIGR02517: type II secretion system protein D" amino acids 44 to 684 (641 residues), 603.6 bits, see alignment E=2e-185 PF03958: Secretin_N" amino acids 137 to 196 (60 residues), 45.9 bits, see alignment 7.9e-16 amino acids 201 to 267 (67 residues), 36.4 bits, see alignment 7.4e-13 amino acids 274 to 426 (153 residues), 37.6 bits, see alignment E=3.2e-13 PF00263: Secretin" amino acids 510 to 675 (166 residues), 157.7 bits, see alignment E=3.3e-50

Best Hits

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 58% identity to pen:PSEEN2332)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (863 amino acids)

>GFF104 General secretion pathway protein D (Variovorax sp. SCN45)
MRRWTLACCIGLACTTAGAATTAPVPTTAPAQAARAGKDDKVVLNFVDADITSVVSALAR
FLGRNFLFDPRVKGQITLVSEGEVPAATAYGMLSTALRMRGFAIVDVGEVSRVVPVADAK
LQGGSVNTRNPGGGLATRTFRLNYENAEAMLPVLKPLIAAENSINAYPANNTLVVTDYID
NLERLARIIESIDTPTSLDAEVVKLRNGVAVDIAGLATELLEGSGEKGRRDIVVLADPRS
NSVVIRSSSPGRTTLARELIAKLENAQSDPGNLHVVYLRNAQSVHLAGVLRGLLTGESPD
ASGTGSGSVRAALGAGGMLGGAGAANGTSGGAANASSANRGSTGGTGTGVSTMPSGGLRG
VAGGASAGGTGTQAGTSGNSNGAAFSAGGVTVQADATTNTLIIAAPEPMYRSLRRVIDTL
DQRRAQVLVESLIVEVTERDASELGIQWMAGGGNGRGVRAGTNFGGATLNPNARNTIEAM
PRGLNIGIVDGTVNLPGVGEILNLKMLARALQAKDGANILSTPNILTLDNEAASIMVGKT
VPFVSGQYITNGNSSTNPFQTIQREDIGLKLNIRPQISEGGTVKLDIYQEVSTIDTQASD
ISGIVTNKRALDTSILVDDGQIMVLGGLMEDSVANGTEAVPGLGALPVVGNLFRYDKRQR
VKTNLMVFLRPYVIRDANAGRGLTLDRYNFMRAQQGRARPVPHGLLPDVGGPALPPADLP
VSGRAPEVDLRPQNWEHTREQPPPPTTTASAVRQQPAEAAPPPPVLRSQLPRGVTVDSDP
AVLYGGANDKVSVLQIADVTTEQDAVRIVKRVRISGIGAYIVGGPGGEGNLVRADVPRDP
KAVDNALSVLRELGYRPELVVTP