Protein Info for GFF1038 in Xanthobacter sp. DMC5

Annotation: Lipoprotein-releasing system transmembrane protein LolE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 40 to 66 (27 residues), see Phobius details amino acids 289 to 313 (25 residues), see Phobius details amino acids 333 to 361 (29 residues), see Phobius details amino acids 370 to 385 (16 residues), see Phobius details amino acids 397 to 418 (22 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 22 to 432 (411 residues), 494 bits, see alignment E=1.7e-152 PF12704: MacB_PCD" amino acids 48 to 261 (214 residues), 63.6 bits, see alignment E=3.2e-21 PF02687: FtsX" amino acids 292 to 425 (134 residues), 45.4 bits, see alignment E=7.9e-16

Best Hits

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 93% identity to xau:Xaut_4462)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>GFF1038 Lipoprotein-releasing system transmembrane protein LolE (Xanthobacter sp. DMC5)
MTATHAAARAGGDTTGTRPFAPFEWMLSLRYLRARRKEGFISVIAGFSFLGIMLGVATLI
IVMAVMNGFRQELLGKILGLNGHVLVQPLESPLTDYKAVAARIAALNGIRLAVPLVEGQA
LASSPFGASGVLVRGMAEKDLRGLPSVAHNIRQGTLENFDQGQGIAIGKRLADQLSLRAG
DNITLVAPRGAVTPMGTSPRIKVYKIAAVFEVGMSEYDSAFVFMPLPEAQAYFNRNGDVN
AIEVYLDNPDDVGELRAAIQSAAERPVYLVDWRVRNATFFGALQVERNVMFLILTLIVLV
AALNIVSGLIMLVKDKGHDIAILRTMGATQGSIMRIFFITGASIGVVGTLSGLLLGVIVC
LNIESIRQFISWLTSTELFSPELYYLSRLPAQMNFGETSSVVLMAMALSFLATLYPSWRA
ARLDPVEALRYE