Protein Info for PS417_05260 in Pseudomonas simiae WCS417

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 261 to 286 (26 residues), see Phobius details amino acids 297 to 315 (19 residues), see Phobius details amino acids 327 to 345 (19 residues), see Phobius details amino acids 352 to 374 (23 residues), see Phobius details amino acids 386 to 406 (21 residues), see Phobius details amino acids 418 to 437 (20 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 314 (285 residues), 92.5 bits, see alignment E=2.7e-30 PF00083: Sugar_tr" amino acids 36 to 423 (388 residues), 83.6 bits, see alignment E=1.5e-27

Best Hits

KEGG orthology group: None (inferred from 99% identity to pfs:PFLU1074)

Predicted SEED Role

"Putative sugar transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UAT0 at UniProt or InterPro

Protein Sequence (446 amino acids)

>PS417_05260 MFS transporter (Pseudomonas simiae WCS417)
MSIYNKLDLTGWKPRQLTSKEVRFATWIAFFAWVFAVYDFILFGTLLPEIGRHFGWGEVE
QAEIATWVAVGTAVVAFAIGPVVDKLGRRTGIIFTVAGSALCSALTAIGGAWGKSPLILI
RSLGGLGYAEETVNATYLSELYGASEDPRLTKRRGFIYSLVQGGWPVGALIAAGLTALLL
PIIGWQGCFIFAAIPAIVIAIMARKLKESPQFQIHQRISELRKSGAVKEAQNVAVTYGVD
YDEHSKAGLKAAFRGPARRATLVIGAALLLNWAAIQVFSVLGTSVIVSVHHISFENSLII
LVLSNLVGYCGYLSHGWMGDKIGRRNVIGLGWMLGGLSFAGMLFGPSNMPMVVGLYSLGL
FFLIGPYSAALFFISESFPTSIRATGGAIIHAMGPIGAVVAGFGATQVLSAGSDWQTAAL
WFGALPCFLSGALMFAARHVRPETVQ