Protein Info for GFF1037 in Xanthobacter sp. DMC5

Annotation: Lipoprotein-releasing system ATP-binding protein LolD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF00005: ABC_tran" amino acids 44 to 191 (148 residues), 108.7 bits, see alignment E=1.9e-35

Best Hits

Swiss-Prot: 70% identical to LOLD2_RHOPA: Lipoprotein-releasing system ATP-binding protein LolD 2 (lolD2) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K09810, lipoprotein-releasing system ATP-binding protein [EC: 3.6.3.-] (inferred from 85% identity to xau:Xaut_4461)

MetaCyc: 49% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Lipoprotein releasing system ATP-binding protein LolD"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>GFF1037 Lipoprotein-releasing system ATP-binding protein LolD (Xanthobacter sp. DMC5)
MDMPTPSEGRSAGRAPGARPQFALALSGVVRRYAQGQGALEILRGADLGITHGQSVALVA
PSGSGKSTLLHIAGLLEHSDAGEVFIDGAPTARLPDAERTRIRRLSIGFVYQFHHLLPEF
TALENVAMPQMIRGLGKKEAEARAKELLSYLGLGARLTHRPSELSGGEQQRVAIARALAN
APRLLLADEPTGNLDPKTSDHVFGAMSELVRATGVAALIATHNLDLAARMDRRVTLREGK
VVELA