Protein Info for PS417_05225 in Pseudomonas simiae WCS417

Annotation: tRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00740: tRNA (cmo5U34)-methyltransferase
  • amino acids 6 to 246 (241 residues), 288.9 bits, E=1.6e-90
• PF00891: Methyltransf_2
  • amino acids 54 to 192 (139 residues), 27 bits, E=5.4e-10
• PF13649: Methyltransf_25
  • amino acids 63 to 163 (101 residues), 43.6 bits, E=8e-15
• PF08241: Methyltransf_11
  • amino acids 63 to 167 (105 residues), 41.4 bits, E=3.8e-14
• PF08242: Methyltransf_12
  • amino acids 63 to 165 (103 residues), 34.3 bits, E=6.4e-12

Best Hits

Swiss-Prot: 98% identical to CMOA_PSEFS: Carboxy-S-adenosyl-L-methionine synthase (cmoA) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K15256, tRNA (cmo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 98% identity to pfs:PFLU1067)

MetaCyc: 55% identical to carboxy-S-adenosyl-L-methionine synthase (Escherichia coli K-12 substr. MG1655)
RXN0-7066

Predicted SEED Role

"tRNA (uridine-5-oxyacetic acid methyl ester) 34 synthase"

MetaCyc Pathways

• 5-(methoxycarbonylmethoxy)uridine biosynthesis (1/3 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See A0A1N7U7I5 at UniProt or InterPro

Protein Sequence (247 amino acids)

>PS417_05225 tRNA methyltransferase (Pseudomonas simiae WCS417)
MSKEPDRLFAQPLPQVPDFAFNEDVVRVFPDMIKRSVPGYPTIVENLGVLAAQFAQPNSV
LYDLGSSLGAVTQALRRHVRTDGCRVIAVDNSAAMVERCREYLNGQDSMFQELLPVEVIE
GDILALQFQPASVVALNFTLQFIAPDERLALLSRIRQSLLPGGALILSEKLRFNDAQEHA
LLTDLHIAFKRANGYSELEIAQKRSAIENVMKPDSLEEHRERLLAAGFSTVVPWFQCLNF
ASLIALP