Protein Info for PS417_05220 in Pseudomonas simiae WCS417

Annotation: tRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08003: Methyltransf_9
  • amino acids 9 to 318 (310 residues), 482.4 bits, E=1.3e-148
• TIGR00452: tRNA (mo5U34)-methyltransferase
  • amino acids 10 to 317 (308 residues), 464.6 bits, E=5.9e-144
• PF13489: Methyltransf_23
  • amino acids 111 to 266 (156 residues), 44.6 bits, E=3.4e-15
• PF13847: Methyltransf_31
  • amino acids 118 to 237 (120 residues), 29.5 bits, E=1.3e-10
• PF13649: Methyltransf_25
  • amino acids 122 to 214 (93 residues), 30 bits, E=1.8e-10
• PF08241: Methyltransf_11
  • amino acids 123 to 220 (98 residues), 27.6 bits, E=9.2e-10

Best Hits

Swiss-Prot: 96% identical to CMOB_PSEFS: tRNA U34 carboxymethyltransferase (cmoB) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K15257, tRNA (mo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 96% identity to pfs:PFLU1066)

Predicted SEED Role

"tRNA (5-methoxyuridine) 34 synthase"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See A0A1N7TV44 at UniProt or InterPro

Protein Sequence (318 amino acids)

>PS417_05220 tRNA methyltransferase (Pseudomonas simiae WCS417)
MIDLSPLARHLVGTPLAVWAQGLQAQLDSKMEKGHGDLERWQSALDALPKIQPSEVDLLN
GLTLDTHCDDDTRAQMHTALMGLSPWRKGPFNLFGVHVDTEWRSDWKWSRVAPHLNLKGK
RILDVGCGNGYYMWRMLGAGADSVIGVDPNWLFFCQFQAVQRYLSEPKAWHLPFPFEDLP
SNLEGFDTVFSMGVFYHRRSPIEHLLALKDTLVKGGELVLETLVVEGDQQQVLVPEDRYA
QMRNVWFLPSVPALMLWLRRAGFSDVRCVDVSVTTVEEQRGTQWMKYQSLSDFLDPEDHS
KTIEGLPAPMRAVIIAKK