Protein Info for PS417_05215 in Pseudomonas simiae WCS417

Annotation: zinc-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF00383: dCMP_cyt_deam_1" amino acids 13 to 112 (100 residues), 109.2 bits, see alignment E=9e-36 PF14437: MafB19-deam" amino acids 15 to 124 (110 residues), 92.6 bits, see alignment E=1.9e-30

Best Hits

Swiss-Prot: 56% identical to TADA_HAEIN: tRNA-specific adenosine deaminase (tadA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU1065)

Predicted SEED Role

"tRNA-specific adenosine-34 deaminase (EC 3.5.4.-)" in subsystem tRNA processing (EC 3.5.4.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.-

Use Curated BLAST to search for 3.5.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UGJ0 at UniProt or InterPro

Protein Sequence (165 amino acids)

>PS417_05215 zinc-binding protein (Pseudomonas simiae WCS417)
MRQFRPPAIIDRSRDQDFMREALALAAQGAALGEVPVGAVLVQDGEIIGRGFNCPISGND
PSAHAEMVAIRAAAQAISNYRLVGSTLYVTLEPCSMCAGLIVHSRIARVVYGALEPKAGI
VQSQGQFFTQGFLNHKVLFEGGVLAEECGTVLSEFFKARRAKPPR