Protein Info for GFF1029 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases / CDP-6-deoxy-delta-3,4-glucoseen reductase-like

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF00111: Fer2" amino acids 4 to 72 (69 residues), 56.4 bits, see alignment E=3.4e-19 PF00970: FAD_binding_6" amino acids 97 to 189 (93 residues), 48.3 bits, see alignment E=1.6e-16 PF00175: NAD_binding_1" amino acids 200 to 302 (103 residues), 90.6 bits, see alignment E=1.6e-29

Best Hits

KEGG orthology group: K00523, CDP-4-dehydro-6-deoxyglucose reductase [EC: 1.17.1.1] (inferred from 49% identity to bpt:Bpet1991)

Predicted SEED Role

"2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases / CDP-6-deoxy-delta-3,4-glucoseen reductase-like" in subsystem Central meta-cleavage pathway of aromatic compound degradation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.1

Use Curated BLAST to search for 1.17.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>GFF1029 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases / CDP-6-deoxy-delta-3,4-glucoseen reductase-like (Hydrogenophaga sp. GW460-11-11-14-LB1)
MATAIPCAAGQTVLDAVRQAGYEMPFSCNSGVCASCKGRVVSGRVNPGAAGEHTLTADEI
AHGQVLFCQARPLTDIEIEPRQIEKTDPNARRQLAARVMRIDFLASDVARLKLRFPAGEK
VKFKAGQYLQVLLPDGQRRSFSMANPPHQNDGAELHIRMLEGGAFSHWLAHDLKVGDHLR
VELPHGDFHLREGSTAPIVMLASGTGFAPIKSMVEDGLRRGQAREIALYWGARTEKDLYL
LELARGWGEQAGLRFVPVLSEPEAGWSGRTGFVHQAVLQDHDSLAGHQVYACGAPAMVSA
ARSDFVETRGLPPDAFFCDAFVVAQPRTSALTD