Protein Info for GFF1025 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 21 to 34 (14 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 103 to 126 (24 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 220 to 237 (18 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details PF01569: PAP2" amino acids 144 to 264 (121 residues), 84.7 bits, see alignment E=2.4e-28

Best Hits

KEGG orthology group: None (inferred from 64% identity to xau:Xaut_4552)

Predicted SEED Role

"Phosphatidylglycerophosphatase B (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>GFF1025 hypothetical protein (Xanthobacter sp. DMC5)
MSAETGTGAAQSGSFAAGLRTVGEGVRLLLVSIWRGLDYLRARRVGVPRPRLGFLGRWEA
LALAVLTAGVVAALMLLVDPLTMGLRLKAPSWLVIFSDRLTDLGFSGVVLWPLGIGLAYA
LMLTHVGDEMTRRIAASVAARLGFLFLAIAPVGLLVAIVKHSLGRARPHAAMHIKGPSPE
MTFDFLIWKSSFASFPSGHATTTFAAAVAFAALFPRARTILLVAAFPIAATRIVLSSHYP
SDVVAGAVLGTAAALWTVKLFAARRVVFAVDAGGTIVPMAGPSARRLARLLAPVNPARAG
SSLPPPQDMSTAVPAQEARP