Protein Info for GFF1022 in Variovorax sp. SCN45
Annotation: Acetyltransferase, GNAT family
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 50% identical to MDDA_PSEAE: L-methionine sulfoximine/L-methionine sulfone acetyltransferase (pitA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 93% identity to vpe:Varpa_3676)MetaCyc: 41% identical to L-amino acid N-acyltransferase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]
Predicted SEED Role
"Phosphinothricin N-acetyltransferase (EC 2.3.1.-)" (EC 2.3.1.-)
MetaCyc Pathways
- L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
- superpathway of arginine and polyamine biosynthesis (15/17 steps found)
- L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
- L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
- L-ornithine biosynthesis I (5/5 steps found)
- phosalacine biosynthesis (4/25 steps found)
- phosphinothricin tripeptide biosynthesis (4/25 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- Alkaloid biosynthesis I
- Alkaloid biosynthesis II
- Anthocyanin biosynthesis
- Arginine and proline metabolism
- Benzoate degradation via CoA ligation
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of terpenoids and steroids
- Biosynthesis of type II polyketide backbone
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Carotenoid biosynthesis - General
- Diterpenoid biosynthesis
- Ether lipid metabolism
- Ethylbenzene degradation
- Fatty acid biosynthesis
- Glycerophospholipid metabolism
- Glycosphingolipid biosynthesis - ganglio series
- Histidine metabolism
- Limonene and pinene degradation
- Lipopolysaccharide biosynthesis
- Lysine degradation
- Phenylalanine metabolism
- Tyrosine metabolism
- Urea cycle and metabolism of amino groups
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.1, 2.3.1.183
Use Curated BLAST to search for 2.3.1.- or 2.3.1.1 or 2.3.1.183
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (173 amino acids)
>GFF1022 Acetyltransferase, GNAT family (Variovorax sp. SCN45) MRLIPCTEEAHAAAILAILNEAIVTSTALYDYKPRAPENMVAWFATKRANGFPVIGAVDD DGKLLGFASYGAFRAFPAYKYTVEHSVYVDSAHRGAGLGRTLMEAIIAEAIARDVHVMVG AIDAANAGSIALHERLGFEHSGTVRQAGFKFGRWLDVAFYQRILATPLNPVDG