Protein Info for GFF1020 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: DNA replication protein DnaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF01695: IstB_IS21" amino acids 46 to 237 (192 residues), 53.5 bits, see alignment E=3.7e-18 PF00308: Bac_DnaA" amino acids 66 to 181 (116 residues), 27.5 bits, see alignment E=4.9e-10 PF00004: AAA" amino acids 103 to 217 (115 residues), 30.1 bits, see alignment E=8.8e-11

Best Hits

Swiss-Prot: 94% identical to DNAC_SHIFL: DNA replication protein DnaC (dnaC) from Shigella flexneri

KEGG orthology group: K02315, DNA replication protein DnaC (inferred from 99% identity to sed:SeD_A4957)

Predicted SEED Role

"DNA replication protein DnaC" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>GFF1020 DNA replication protein DnaC (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKNVGDLMQRLQKMMPAHITPAFKTGEELLAWQKEQGEIRAAALARENRAMKMQRTFNRS
GIRPLHQNCSFDNYRVECDGQMNALSKARQYVDEFDGNIASFVFSGKPGTGKNHLAAAIC
NELLLRGKSVLIITVADIMSAMKDTFSNRETSEEQLLNDLSNVDLLVIDEIGVQTESRYE
KVIINQIVDRRSSSKRPTGMLTNSNMEEMTKMLGERVMDRMRLGNSLWVNFTWDSYRSRV
TGKEY