Protein Info for GFF1018 in Xanthobacter sp. DMC5

Annotation: Cystathionine beta-lyase MetC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 PF01053: Cys_Met_Meta_PP" amino acids 22 to 395 (374 residues), 342.8 bits, see alignment E=9.5e-107 TIGR01324: cystathionine beta-lyase" amino acids 23 to 397 (375 residues), 513.9 bits, see alignment E=1e-158

Best Hits

Swiss-Prot: 52% identical to METC_RHIL3: Putative cystathionine beta-lyase (metC) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K01760, cystathionine beta-lyase [EC: 4.4.1.8] (inferred from 76% identity to xau:Xaut_4545)

Predicted SEED Role

"Cystathionine beta-lyase (EC 4.4.1.8)" in subsystem Methionine Biosynthesis (EC 4.4.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>GFF1018 Cystathionine beta-lyase MetC (Xanthobacter sp. DMC5)
MSDASRDDHGADGASGAERGTATKIVHAGRDPRRFDGFVNTPVVRGSTVLYPNYDDLIHH
RARYTYGRHGNPTSESLQVALTALEGGDGVVLTPSGLSAVTTALLAVAGSGDHVLVVDSV
YRPTRNFCDGLFARLGVETTYYDPLIGAGIEALIRPNTKAIFLEAPGSQSFEMQDVPAIV
AVAKARGITTLIDNTWATPVFFKPHAFGVDISIQSGTKYICGHADVSIGTISAVGDALRK
VRATYSALGMTVGPDDIALAARGLRTLAVRLAHHEKAALEMAEWLAARPEVSRVLHPALP
SDPGHAIWKRDFCGASGLFSLILKPVPEAAVAAFFDALTLFGMGYSWGGYESLAIPFDCK
DYRTATRWEVEGPGVRVHIGLEDTADLKADLDHAFARMREVAAA