Protein Info for GFF1017 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Probable vanillate O-demethylase oxygenase subunit oxidoreductase protein (EC 1.14.13.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 PF00355: Rieske" amino acids 6 to 96 (91 residues), 76.1 bits, see alignment E=2.5e-25 PF19112: VanA_C" amino acids 140 to 337 (198 residues), 163.6 bits, see alignment E=9.6e-52

Best Hits

Swiss-Prot: 71% identical to VANA_PSEUH: Vanillate O-demethylase oxygenase subunit (vanA) from Pseudomonas sp. (strain HR199 / DSM 7063)

KEGG orthology group: K03862, vanillate monooxygenase [EC: 1.14.13.82] (inferred from 72% identity to csa:Csal_0344)

MetaCyc: 71% identical to vanillate O-demethylase oxygenase component (Pseudomonas sp. HR199)
Vanillate monooxygenase. [EC: 1.14.13.82]

Predicted SEED Role

"Probable vanillate O-demethylase oxygenase subunit oxidoreductase protein (EC 1.14.13.-)" in subsystem Phenylpropanoid compound degradation (EC 1.14.13.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-, 1.14.13.82

Use Curated BLAST to search for 1.14.13.- or 1.14.13.82

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>GFF1017 Probable vanillate O-demethylase oxygenase subunit oxidoreductase protein (EC 1.14.13.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MFPKNTWYVGATPSELDGKPLGRKICGESIVFFRGPDNKVAAVEDFCPHRGAPLSLGKVE
NGKLVCGYHGLEMGCDGKTVAMPCQRVGGFPAVRTYPVVERYGFIWVWPGDAQEADPSKI
HHLAWADDPEWAYSGGLYHVKCDYRLMIDNLMDLTHETYLHPNSIGQKEIDESPPKTRMD
GDCAITERYMEGIMAPPFWRAGLRGNNLADDVPVDRWQICRFYPPSHVLIDVGVAHAGKG
GFNADPKVKASSTVIDFITPETESSTWYFWGMARNFNAQDQALSEQIRTSLSKVFSEDLQ
MLEMQQQNLERNAGRKLLSLNIDGGGVQARRIIDRLLVAEKSAA