Protein Info for GFF1016 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (EC 2.6.1.16)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 transmembrane" amino acids 42 to 61 (20 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details PF01380: SIS" amino acids 40 to 164 (125 residues), 48.1 bits, see alignment E=5.2e-17

Best Hits

KEGG orthology group: None (inferred from 99% identity to seg:SG4369)

MetaCyc: 100% identical to putative glucoselysine 6-phosphate deglycase (Salmonella enterica enterica serovar Typhimurium str. 14028S)
RXN1QP9-73

Predicted SEED Role

"Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (EC 2.6.1.16)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.6.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.16

Use Curated BLAST to search for 2.6.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>GFF1016 Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (EC 2.6.1.16) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSPTMLTYINEESDVLANIIRRHRQSLEEVSRFASQKTLRRILILATGSSLNAAFCARYF
FERCGISIDIKEPYTFSQYENSDPQADMVIAISQSGKSASTLEAMRKVQAQGRPVFALTA
DPQSPLGKASDYPLDILTGIESVGFVTRGFSATVLNLLLIALLIARQQQRLTESQVEEYV
AQLQRIAATLPLVIVRTEAFIHQHQAVLRNGTRFVATGYGALVGVAKELETKFTETVRVP
SSGFELEAYMHGPYLEANAEHVMFFFEDRPDARSRALREYMTPAVAKTFTLTLAKAAQDD
QTLALDVAVDHHFSPLLLIVPVQLMAFHIASLKGIDLSVRIFDDFDRVLKSKI