Protein Info for GFF1015 in Sphingobium sp. HT1-2

Annotation: Fumarylacetoacetate hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF01557: FAA_hydrolase" amino acids 67 to 274 (208 residues), 235.2 bits, see alignment E=3.5e-74

Best Hits

Swiss-Prot: 56% identical to UGL_BURL3: Ureidoglycolate lyase (Bcep18194_B0137) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: None (inferred from 67% identity to aex:Astex_2136)

MetaCyc: 90% identical to 2,4-didehydro-3-deoxy-L-fuconate hydrolase (Sphingomonas sp. SKA58)
RXN-12096 [EC: 3.7.1.26]

Predicted SEED Role

"Fumarylacetoacetate hydrolase family protein" in subsystem Gentisare degradation or Salicylate and gentisate catabolism

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>GFF1015 Fumarylacetoacetate hydrolase family protein (Sphingobium sp. HT1-2)
MKFVRFGQRGQEKPGVIDAEGKIRDLSGVVADLTIESLAAAKGVDVDSLPVVDGDPRYGV
PVKGIGKIVAIGLNYEDHAIESNLPIPTEPMMFMKALSSLNGPNDEVMLPKGATHGDWEV
ELGVVIGETCRFVSEEEALSKVAGYVLVNDVSERFNQKQRGTQWSKGKGHDTFCPVGPWL
VTADEIGNPQDLDMYLDVNGDRMQTGNTRTMIFNVAQLISYVSEYITLYPGDLMITGTPP
GVGEGKKPEAVYLKAGDVMELGIAKLGSQKQNVVEWRHLGDEVLG