Protein Info for GFF1014 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: PTS system, mannose-specific IIC component (EC 2.7.1.69)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 45 to 63 (19 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 92 to 117 (26 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 205 to 234 (30 residues), see Phobius details PF03609: EII-Sor" amino acids 2 to 232 (231 residues), 238.1 bits, see alignment E=4.6e-75

Best Hits

KEGG orthology group: K02795, PTS system, mannose-specific IIC component (inferred from 99% identity to see:SNSL254_A4892)

MetaCyc: 100% identical to fructoselysine/glucoselysine PTS enzyme IIC component (Salmonella enterica enterica serovar Typhimurium str. 14028S)
2.7.1.-; 2.7.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>GFF1014 PTS system, mannose-specific IIC component (EC 2.7.1.69) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MVEALLLGLVAFIAQSEYALGTSLISRPIVTGLLTGLVLGDMETGIVMGATLELAFIGSF
SVGASLPPDVVTGGILGVAFAINSGAGAETALLLGLPIATLALIVKNIYNGMFIPLLCHK
ADAYAEVGDTRGIERMHLISGIGLSLMLGIIVTVSYLAGVNMVKGFLDAIPEFIKHGLSV
ATGIIPALGFAMLARLLINKKVAPYFFLGFVLMAYLKIPVTGIAILGAIVAVVMVNMPKF
AASQPAPAQGASHDDEDDF