Protein Info for GFF1013 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: PTS system, mannose-specific IIB component (EC 2.7.1.69)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 PF03830: PTSIIB_sorb" amino acids 2 to 149 (148 residues), 160.1 bits, see alignment E=2.5e-51

Best Hits

Swiss-Prot: 33% identical to PTRB_LACCA: PTS system sorbose-specific EIIB component (sorB) from Lactobacillus casei

KEGG orthology group: K02794, PTS system, mannose-specific IIB component [EC: 2.7.1.69] (inferred from 100% identity to sed:SeD_A4950)

MetaCyc: 100% identical to fructoselysine/glucoselysine PTS enzyme IIB component (Salmonella enterica enterica serovar Typhimurium str. 14028S)
2.7.1.-; 2.7.1.-

Predicted SEED Role

"PTS system, mannose-specific IIB component (EC 2.7.1.69)" in subsystem Mannose Metabolism or Sialic Acid Metabolism (EC 2.7.1.69)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (153 amino acids)

>GFF1013 PTS system, mannose-specific IIB component (EC 2.7.1.69) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIVFLRVDHRLLHGQVAFSWTQYVGADCILIANDSVPNDDLRKTTIKMAKPPAVKLVIKN
IADSIEAIKSGVTDKYKLFIVVESVADAYRLARELPDIKSINLGGTKVREGSQNIAKAIN
LLADEMTQLRELAAGGVEIEIRLVPNDRKQLFA