Protein Info for GFF1012 in Sphingobium sp. HT1-2

Annotation: Sugar:proton symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 97 to 121 (25 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details amino acids 330 to 349 (20 residues), see Phobius details PF06379: RhaT" amino acids 6 to 349 (344 residues), 221.4 bits, see alignment E=9.8e-70

Best Hits

KEGG orthology group: K02856, L-rhamnose-H+ transport protein (inferred from 63% identity to nar:Saro_1049)

Predicted SEED Role

"L-rhamnose-proton symporter" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>GFF1012 Sugar:proton symporter (Sphingobium sp. HT1-2)
MTPNPLLGVLFHWLGGFASASFYVPFRGVKRWNWEIFWLTGGIFSWVIAPWFFASVQTND
LMGVMAQVPSSVVGWCIFFGFLWGFGGLTYGLTMRYLGLSLGMAVVLGLCTVFGTLIPPI
FDGTFMTEIAGTLHGQIVLLGLAVTVLGIVVVARAGARKDAALSTEQKAAVVADFDFKKG
IAVAIFSGIMSSCFAFGLAAGEPVKALSAAAGTGPLWTGLPTLCLVMFGGLITNALWCGW
LIARNKSAGQWAGAPDASGQRPKLLPNFLLCAVAGTAWYFQFFFYTMGESQMGRFGFSSW
TLHMASIIIFGTCWGFAFREWKDAAPAVRRMVWGGVGLLILATLIIGYGNRLAS