Protein Info for GFF1011 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Transcriptional regulatory protein levR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 921 PF00158: Sigma54_activat" amino acids 106 to 271 (166 residues), 145.5 bits, see alignment E=4.5e-46 PF01078: Mg_chelatase" amino acids 129 to 257 (129 residues), 23.5 bits, see alignment E=1.2e-08 PF14532: Sigma54_activ_2" amino acids 129 to 263 (135 residues), 34.4 bits, see alignment E=8.4e-12 PF07728: AAA_5" amino acids 132 to 256 (125 residues), 26.3 bits, see alignment E=2.3e-09 PF00004: AAA" amino acids 133 to 278 (146 residues), 26 bits, see alignment E=4e-09 PF03610: EIIA-man" amino acids 564 to 632 (69 residues), 21.9 bits, see alignment 5.6e-08 PF00874: PRD" amino acids 826 to 907 (82 residues), 39.6 bits, see alignment E=1.8e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to sei:SPC_4672)

Predicted SEED Role

"Transcriptional regulatory protein levR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (921 amino acids)

>GFF1011 Transcriptional regulatory protein levR (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRKDALLAFLMNQTDFFDPENVSEVFTARYLAQRFNMQRNTASHYLNQLVAQGVLCKINT
RPVYFLHKQAFSQQFFTLSRNEYASVAELLAHGEQECAPDDHFSLLIGHNESLKRPIEQL
KTALFYPDGGLPLLMTGESGTGKSYLAQLMHEYAIAQALLSPDAPFISFNCAQYASNPEL
LAANLFGYVKGAFTGAQSDRPGAFEAADGGMLFLDEVHRLSAEGQEKLFTWLDRGEIYRV
GDTAQGHPVSVRLVFATTEEIHSTFLTTFLRRIPIQVNLPDLQHRSRQEKEALILLFFWT
EAKKLSATLILKPRLLQILNQYVYRGNVGELKNVVKYAVATAWAKKPGQETVTVSLHDLP
DAMLSALPSLNEPLADDTPVSISPDTNLTWLLRARDEMQGMIHDTQCHVLALYELVRSGK
EGWETVQKRMGDEIETLFDRLIFTGDDNVHSQRLLLITSQVREEFYRLEKRFNMQLNGNC
IYALSHYLIHRTALAPSRLNSEQIRQLDAFLAQKYPLLYSFCLQILETLGQKLDLEPRRI
DMLLLALWLHKQGANNQKQVTHAVILAHGYATASSIANVANRLLKNTIFESFDMPLDVTP
EAIAQQVMRYLEEHPLASGLMILVDMGSLKAIHRHFDRALSTPVTIINNVSTSMALYVGE
RILQGHFIEEIARDIARDVPVEYQLYWPKSNKPRAILTTCATGIGVATNLCALLSASIPQ
ALEIDVVACDYAMLASNKTQEPVFMRYDVLAIVGTLDPHIASVPWISLDSLISGEGNHYL
MRLFGSLTTPEQVAEINNLLLKNFSLRRVIESVTILDTSKVINHVEQFLLRYEHLAGVTV
SNERKVALYVHISCLIERLIRHAGITAWSGQQCPEQELNRLREAFSVIESNYSVKIPTAE
LGYIHNILTFETELIEQDQQF