Protein Info for GFF1010 in Xanthobacter sp. DMC5

Annotation: ATP-dependent Clp protease ATP-binding subunit ClpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 816 TIGR02639: ATP-dependent Clp protease ATP-binding subunit ClpA" amino acids 5 to 741 (737 residues), 1127.1 bits, see alignment E=0 PF02861: Clp_N" amino acids 15 to 63 (49 residues), 41.5 bits, see alignment 7.9e-14 PF00004: AAA" amino acids 219 to 350 (132 residues), 49.5 bits, see alignment E=4e-16 amino acids 500 to 618 (119 residues), 47 bits, see alignment E=2.4e-15 PF17871: AAA_lid_9" amino acids 359 to 461 (103 residues), 93.7 bits, see alignment E=3.9e-30 PF07724: AAA_2" amino acids 494 to 654 (161 residues), 193.7 bits, see alignment E=1.6e-60 PF00158: Sigma54_activat" amino acids 500 to 616 (117 residues), 20.6 bits, see alignment E=2.1e-07 PF07728: AAA_5" amino acids 500 to 616 (117 residues), 49.6 bits, see alignment E=2.7e-16 PF10431: ClpB_D2-small" amino acids 662 to 741 (80 residues), 86.3 bits, see alignment E=7.4e-28

Best Hits

Swiss-Prot: 73% identical to CLPA_RHOBL: ClpA homolog protein from Rhodobacter blasticus

KEGG orthology group: K03694, ATP-dependent Clp protease ATP-binding subunit ClpA (inferred from 90% identity to azc:AZC_1595)

MetaCyc: 59% identical to ATP-dependent Clp protease ATP-binding subunit ClpA (Escherichia coli K-12 substr. MG1655)
Endopeptidase Clp. [EC: 3.4.21.92]

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpA" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.92

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (816 amino acids)

>GFF1010 ATP-dependent Clp protease ATP-binding subunit ClpA (Xanthobacter sp. DMC5)
MPTFSRSLEQSLHRALALANERHHEYATLEHLLLSLVDDQDAAAVMRACNVDMEKLRRNL
IEYVDTELENLVQSGSDDSKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERESH
AAYFLQEQDMTRYDAVNYISHGIAKRSGMSESRPVRGADEETETKSGDDKQKKADALDAY
CINLNKKAHEGKIDPLIGRDSEITRTIQVLCRRQKNNPLFVGDPGVGKTAIAEGLAKRIN
DGEVPEVLATATVFALDMGALLAGTRYRGDFEERLKQVVKEIEAYPNAIMFIDEIHTVIG
AGATSGGAMDASNLLKPALASGSLRCMGSTTYKEYRQYFEKDRALVRRFQKIDVAEPTVP
DAIEILKGLKPYFEDYHKLRYTNDAIKAAVELSARYIHDRKLPDKAIDVIDESGAAQMLL
PEAKRKKTIGLKEIEATIATMARIPPKTVSKDDAEVLANLQTTLKRVVYGQNKAIEALSA
SIKLARAGLREPEKPIGCYLFSGPTGVGKTEVAKQLASILGVQLLRFDMSEYMERHTVSR
LIGAPPGYVGFDQGGLLTDGVDQNPHCVLLLDEIEKAHPDLFNILLQVMDHGKLTDHNGK
QIDFRNVILIMTTNAGAADLAKPAYGFTRQKREGDDSEAISRTFAPEFRNRLDAVIPFGH
LPPEVITQVVEKFVLQLEAQLADRNVTIELSDEAGTWLVDRGYDEQMGARPMARVIQEFI
KTPLADLVLFGALKNGGHVRVVVEGEGKDSKLGFEFPEGPVTPKPEKIVPAPAKRRKPAA
KSKAKPTPKGKGPKGGPAGGSGRSGSPVPKLPLVKA