Protein Info for GFF100 in Xanthobacter sp. DMC5

Annotation: Ubiquinone biosynthesis O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase
  • amino acids 12 to 240 (229 residues), 267.2 bits, E=4.8e-84
• PF13489: Methyltransf_23
  • amino acids 60 to 214 (155 residues), 79.8 bits, E=7.3e-26
• PF02353: CMAS
  • amino acids 62 to 171 (110 residues), 30.4 bits, E=8.7e-11
• PF13847: Methyltransf_31
  • amino acids 63 to 167 (105 residues), 47.8 bits, E=4.3e-16
• PF06325: PrmA
  • amino acids 64 to 165 (102 residues), 25.3 bits, E=3.8e-09
• PF13649: Methyltransf_25
  • amino acids 68 to 159 (92 residues), 60.5 bits, E=7.3e-20
• PF08242: Methyltransf_12
  • amino acids 68 to 161 (94 residues), 56.7 bits, E=1.2e-18
• PF08241: Methyltransf_11
  • amino acids 68 to 163 (96 residues), 70.1 bits, E=7.2e-23

Best Hits

Swiss-Prot: 66% identical to UBIG_AZOC5: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 87% identity to xau:Xaut_3086)

MetaCyc: 50% identical to 2-polyprenyl-6-hydroxyphenol methylase (Cereibacter sphaeroides)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; RXN-9233 [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

• superpathway of chorismate metabolism (41/59 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (7/12 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (4/8 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (4/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (4/9 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (3/8 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (3/9 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (4/11 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (2/9 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Protein Sequence (247 amino acids)

>GFF100 Ubiquinone biosynthesis O-methyltransferase (Xanthobacter sp. DMC5)
MPQMNATVDPEEVSRFEALGAQWWDVKGKMAPLHAMNPARLAFLRDTLVRHFSRDARSLR
PLKGLSLVDIGCGGGLLSEPLSRMGADVTGIDPAPGNVDIARAHAAQSGLAVTYEAETAE
ALAERGARFDVVVALEVVEHVADVGLFVRTAGRLVADGGLLVLSTLNRTPKSFALAIVGA
EYVLRWLEPGTHRWEKFVTPEELEATLASAGFVAREKVGLAYEPFSGDFRLTEDLSVNYF
MVAEREA