Protein Info for PS417_00505 in Pseudomonas simiae WCS417

Annotation: peptidase M16

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 433 to 452 (20 residues), see Phobius details PF00675: Peptidase_M16" amino acids 48 to 148 (101 residues), 45.8 bits, see alignment E=6.1e-16 PF05193: Peptidase_M16_C" amino acids 190 to 362 (173 residues), 71.7 bits, see alignment E=7.2e-24

Best Hits

KEGG orthology group: None (inferred from 95% identity to pfs:PFLU0100)

Predicted SEED Role

"Metalloprotease, insulinase family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TWQ4 at UniProt or InterPro

Protein Sequence (460 amino acids)

>PS417_00505 peptidase M16 (Pseudomonas simiae WCS417)
MRRLLFACLLMGSAHAFAFDRLQVEGYTLPNGLQLLLKPGTERGHVAIRLVVGVGLDDFG
CEDKELPHLLEHLLFSGIDGGGEGELEDRMQALGGEWNAYTSNADTTFVIEAPAQNQRKV
LDLLLAIITRTELTDANINAAKRVVEREDGGHYSHLQRLLDRQDLGHTASNQLAVELGLK
CAERAQVDHLTRDQLENLRKHWYAPNNMTLIIVGDLDKLLPAYLERTYGQLEPVEPSEHL
ALPEIQHAAASHRELIHGWVGDGAKLHWLFPEPVLDDGHDETYDLLKDYLDWALYRQLRL
KHGLSYGPWSEREVLGGVGFLSLNADLERENLPEAEQVLQDLKAHLLKDGLDPAVFARLQ
QAAIARQAWAVQGNSALADYYWSASGDYNKGHFSDPVKRIKAVSLDQTNQAMRDVFKQPG
YWRIEKPLLSYDALSWIGAGLLGFIAIVLIGLRSYRKRIA