Protein Info for PS417_00050 in Pseudomonas simiae WCS417

Annotation: histidinol phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01662: HAD hydrolase, family IIIA
  • amino acids 2 to 146 (145 residues), 118.9 bits, E=1.9e-38
• TIGR01656: histidinol-phosphate phosphatase domain
  • amino acids 2 to 144 (143 residues), 140.5 bits, E=3.9e-45
• PF00702: Hydrolase
  • amino acids 15 to 138 (124 residues), 42.4 bits, E=2.2e-14
• PF08645: PNK3P
  • amino acids 22 to 131 (110 residues), 37.4 bits, E=4.4e-13
• PF13242: Hydrolase_like
  • amino acids 99 to 169 (71 residues), 52.8 bits, E=6.2e-18

Best Hits

Swiss-Prot: 79% identical to GMHBB_PSEPK: D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (gmhB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03273, D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC: 3.1.3.-] (inferred from 98% identity to pfs:PFLU0009)

Predicted SEED Role

"D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase (EC 3.1.1.-); Histidinol-phosphatase (EC 3.1.3.15)" (EC 3.1.1.-, EC 3.1.3.15)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Alkaloid biosynthesis II
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Ether lipid metabolism
• Fructose and mannose metabolism
• Glycerophospholipid metabolism
• Histidine metabolism
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Retinol metabolism
• Riboflavin metabolism
• Sphingolipid metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-, 3.1.3.-

Use Curated BLAST to search for 3.1.1.- or 3.1.3.- or 3.1.3.15

Sequence Analysis Tools

See A0A1N7TWJ3 at UniProt or InterPro

Protein Sequence (177 amino acids)

>PS417_00050 histidinol phosphatase (Pseudomonas simiae WCS417)
MKLLILDRDGVINYDSDAYIKSVAEWIPLPGSIEAIAQLSKAGWTVAIATNQSGIARGYY
DIATLDAMHTRLRTLVAEQGGEVGLVVYCPHGPDEGCDCRKPKPGMLKTIAEHYNVPLAG
IWFVGDSLGDLEAAKAVDSQPVLVKTGKGDKTQAKNLPVGTLIFDDLAAVAAELINN