Protein Info for PS417_00005 in Pseudomonas simiae WCS417

Annotation: chromosomal replication initiation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 PF11638: DnaA_N" amino acids 4 to 64 (61 residues), 73.2 bits, see alignment E=2.7e-24 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 6 to 503 (498 residues), 632.5 bits, see alignment E=2.1e-194 PF00308: Bac_DnaA" amino acids 170 to 387 (218 residues), 337.8 bits, see alignment E=8.4e-105 PF01695: IstB_IS21" amino acids 206 to 308 (103 residues), 25.3 bits, see alignment E=2.6e-09 PF00004: AAA" amino acids 207 to 317 (111 residues), 25.6 bits, see alignment E=3.6e-09 PF08299: Bac_DnaA_C" amino acids 414 to 482 (69 residues), 109.6 bits, see alignment E=1.6e-35

Best Hits

Swiss-Prot: 95% identical to DNAA_PSEF5: Chromosomal replication initiator protein DnaA (dnaA) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 96% identity to pba:PSEBR_a1)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U7X8 at UniProt or InterPro

Protein Sequence (505 amino acids)

>PS417_00005 chromosomal replication initiation protein (Pseudomonas simiae WCS417)
MSVELWQQCVELLREELPAQQFNTWIRPLQVEAEGDELRVYAPNRFVLDWVNEKYLSRVL
ELLDEHGNGLAPVLSLLIGSKRSSAPRAAPNAPLAAAASQAQAAAAPAVSAPSPAPAPSK
SSAQKNAPENEEPSRDSFDPMAGAASQQAPVRAEQRTVQVEGALKHTSYLNRTFTFENFV
EGKSNQLARAAAWQVADNPKHGYNPLFLYGGVGLGKTHLMHAVGNHLLKKNPNAKVVYLH
SERFVADMVKALQLNAINEFKRFYRSVDALLIDDIQFFARKERSQEEFFHTFNALLEGGQ
QVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKADQAKVDLPHDAA
FFIAQRIRSNVRELEGALKRVIAHSHFMGRDITIELIRESLKDLLALQDKLVSVDNIQRT
VAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIGDVFGGRDHTTVLHACR
KINELKESDADIREDYKNLLRTLTT