Protein Info for GEMAOFIL_04568 in Pseudomonas lactucae CFBP13502

Annotation: 2-alkyl-3-oxoalkanoate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 1 to 248 (248 residues), 38.8 bits, see alignment E=2.4e-13 PF05368: NmrA" amino acids 2 to 98 (97 residues), 37 bits, see alignment E=1.2e-12 PF01370: Epimerase" amino acids 3 to 227 (225 residues), 120.4 bits, see alignment E=3.4e-38 PF02719: Polysacc_synt_2" amino acids 3 to 112 (110 residues), 20.4 bits, see alignment E=1e-07 PF16363: GDP_Man_Dehyd" amino acids 4 to 252 (249 residues), 49.9 bits, see alignment E=1.3e-16 PF01073: 3Beta_HSD" amino acids 4 to 250 (247 residues), 98.9 bits, see alignment E=1.1e-31 PF13460: NAD_binding_10" amino acids 7 to 168 (162 residues), 56.5 bits, see alignment E=1.4e-18 PF07993: NAD_binding_4" amino acids 48 to 170 (123 residues), 51 bits, see alignment E=4.6e-17

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU4851)

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>GEMAOFIL_04568 2-alkyl-3-oxoalkanoate reductase (Pseudomonas lactucae CFBP13502)
MKILVTGASGFIGGRFARFALEQGLDVRVNGRRAEGVEHLVRRGAEFIQGDLNDADLVRD
LCRDVEAVVHCAGAVGLWGRYQDFHQGNVLVTENVVEACLKQRVGRLVHLSSPSIYFDGR
DHLGLTEEQVPKRFKHPYAATKYLAEQKVFGAQEFGLEVLALRPRFVTGAGDMSIFARLL
KMQRKNRLAIVGDGLNKVDFTSIHNLNEALLSSLLAPGSALGRAYNISNGAPVPVWDVVN
YVMRQMELPQVTRYRSYGLSYSVAALNEAFCAMWPGRPEPSLSRLGMQVMNKNFTLDISR
ARHYLDYEPKVSLWTALDEFCGWWKAQDPGLK