Protein Info for GEMAOFIL_04411 in Pseudomonas lactucae CFBP13502

Annotation: L-arabinose-binding periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 30 to 322 (293 residues), 169.2 bits, see alignment E=1.4e-53 PF13407: Peripla_BP_4" amino acids 31 to 298 (268 residues), 63.5 bits, see alignment E=2.3e-21

Best Hits

Swiss-Prot: 58% identical to ARAF_ECOLI: L-arabinose-binding periplasmic protein (araF) from Escherichia coli (strain K12)

KEGG orthology group: K10537, L-arabinose transport system substrate-binding protein (inferred from 97% identity to pfs:PFLU4684)

MetaCyc: 58% identical to arabinose ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-2-RXN [EC: 7.5.2.12, 7.5.2.13]

Predicted SEED Role

"L-arabinose-binding periplasmic protein precursor AraF (TC 3.A.1.2.2)" in subsystem L-Arabinose utilization (TC 3.A.1.2.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.12 or 7.5.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>GEMAOFIL_04411 L-arabinose-binding periplasmic protein (Pseudomonas lactucae CFBP13502)
MLGKNRFKKTLGALALAMAFSGVVSAEEVKIGFLVKQAEEPWFQTEWAFAEKAGKEHGFT
VIKIAVPDGEKTLSAIDSLAANGAKGFVICPPDVSLGPAIVAKAKLNDMKVMAVDDRFVD
AKGNFMEDVPYLGMAAFEVGQKQGAAMAAEAKKRGWDWKETYAVVNTFNELDTGKKRTDG
SIKSLEEAGIPKDHILTAALKTLDVPGSMDATNSALVKLPSGAKNLIIGGMNDNTVLGGV
RATESAGFAAANVIGIGINGTDAIGELKKADSGFFGSMLPSPHIEGYNTALAMYEWVTTG
KEPAKYTAMDEVTLITRANFQEELTKIGLWK