Protein Info for GEMAOFIL_04401 in Pseudomonas lactucae CFBP13502

Annotation: Electron transfer flavoprotein subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 PF01012: ETF" amino acids 3 to 170 (168 residues), 144.3 bits, see alignment E=3.6e-46 PF00766: ETF_alpha" amino acids 190 to 270 (81 residues), 125.3 bits, see alignment E=7.5e-41

Best Hits

Swiss-Prot: 87% identical to ETFA_PSEAE: Electron transfer flavoprotein subunit alpha (etfA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03522, electron transfer flavoprotein alpha subunit (inferred from 99% identity to pfo:Pfl01_4116)

Predicted SEED Role

"Electron transfer flavoprotein, alpha subunit" in subsystem Acetyl-CoA fermentation to Butyrate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>GEMAOFIL_04401 Electron transfer flavoprotein subunit alpha (Pseudomonas lactucae CFBP13502)
MTILVIAEHDNKVLAPATLNTVAAAAKIGGDIHVLVAGQGAGAVAEAAAKIAGVSKVLNA
DNAAYAHQLPENVAPLVAELGAGYSHILAAATSNGKNILPRVAAQLDVDQISEIISVESA
DTFKRPIYAGNAIATVQSTAAIKVITVRATGFDPVAAEGGSAAVEAVAAAHDAGTSSFVG
EELAKSDRPELTAAKIVVSGGRGMQNGDNFKHLYALADKLGAAVGASRAAVDAGFVPNDM
QVGQTGKIVAPQLYIAVGISGAIQHLAGMKDSKVIVAINKDEEAPIFQVADYGLVADLFE
AVPELEKLV