Protein Info for GEMAOFIL_02462 in Pseudomonas lactucae CFBP13502

Annotation: Flavin-dependent monooxygenase, reductase subunit HsaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF01613: Flavin_Reduct" amino acids 11 to 157 (147 residues), 151.7 bits, see alignment E=8.5e-49

Best Hits

Swiss-Prot: 38% identical to FRED_PSEPU: Flavin reductase from Pseudomonas putida

KEGG orthology group: None (inferred from 94% identity to pfs:PFLU2313)

MetaCyc: 39% identical to 3-hydroxy-9,10-seconandrost-1,3,5(10)-triene-9,17-dione 4-hydroxylase reductase component (Mycobacterium tuberculosis H37Rv)
RXN-12446 [EC: 1.5.1.36]

Predicted SEED Role

"Nitrilotriacetate monooxygenase component B (EC 1.14.13.-)" in subsystem Aromatic Amin Catabolism (EC 1.14.13.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.5.1.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>GEMAOFIL_02462 Flavin-dependent monooxygenase, reductase subunit HsaB (Pseudomonas lactucae CFBP13502)
MIDAAIYKQVMGSFPSGVTVITTLDDDGQIVGLTASAFSSLSMDPALVLFCPNYSSDSYP
ILIKNKRFAIHVLSGGQQSEAYAFARKGKDKAQGIEWTLSALGNPILANATAVIECELWR
EYEGGDHAIMVGSVKNLIVPEQANGPLVYCHGKMGALPVPA