Protein Info for GEMAOFIL_02445 in Pseudomonas lactucae CFBP13502

Annotation: Staphyloferrin B transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 43 to 65 (23 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 238 to 262 (25 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 299 to 322 (24 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 287 (277 residues), 102.7 bits, see alignment E=1.1e-33 amino acids 212 to 385 (174 residues), 42.7 bits, see alignment E=1.9e-15

Best Hits

KEGG orthology group: None (inferred from 56% identity to eca:ECA4111)

Predicted SEED Role

"Multidrug resistance protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>GEMAOFIL_02445 Staphyloferrin B transporter (Pseudomonas lactucae CFBP13502)
MPPTRVLITLLFAIQLVSMGAMEMSGPFWPLHLRGLTDSDTLFSLASIAVYVGPMLGILL
TSAFWGRIGDRYGHKLMMIRALAGLTLTQLGLALFSELWTILFLRFLQGAFAGYIAPAQA
YGVSIEVPSRRARLFALLQISTNVGSLLGAVVGGLILDHATFFWINLSAAVLCAVCTVIA
AVTLPDVPPVKKNATVSKRGTWQAPALLPLLTVMGILLLARMLPQTSFALYVSSTFTVSN
AMVGLCYGLLALGFILSATAWARHFEGRTQADTLRRLTSVVIGCIALTTMAGVTRNPVVF
VILYFLWGVLLGATTPVLMALISKSVDSTQQGHVLGIAQGSAQFASIAGISAGGLLSQVY
GLAYTYLFVCLAYAAALIAILALRYRRVCT