Protein Info for GEMAOFIL_00729 in Pseudomonas lactucae CFBP13502

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details PF03458: Gly_transporter" amino acids 4 to 77 (74 residues), 80.7 bits, see alignment E=3e-27 amino acids 90 to 162 (73 residues), 77.4 bits, see alignment E=3.1e-26

Best Hits

Swiss-Prot: 53% identical to Y1240_HAEIN: UPF0126 membrane protein HI_1240 (HI_1240) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU0513)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>GEMAOFIL_00729 hypothetical protein (Pseudomonas lactucae CFBP13502)
MLLMLYLIAITAEAMTGALSAGRRGMDWFGVVLIACVTALGGGSVRDVLLGHYPLTWVKH
PEYLVLTSVAALVTIFAAPLMRHLRSLFLALDAVGLVAFTLIGCMTALEMGHGMLVASVS
GVITGVFGGILRDIFCNDIPLIFRRELYASVSFLAAWFYLLCLYLELPSEQAILLTLFSG
FLLRLLAIRFHWEMPKFVYNDDVH