Protein Info for Echvi_4682 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Ferredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 PF00111: Fer2" amino acids 12 to 90 (79 residues), 34.9 bits, see alignment E=5.8e-13

Best Hits

Swiss-Prot: 41% identical to CNDB2_SPHSD: Chloroacetanilide N-alkylformylase 2, ferredoxin component (cndB2) from Sphingomonas wittichii (strain DC-6 / KACC 16600)

KEGG orthology group: K04755, ferredoxin, 2Fe-2S (inferred from 58% identity to sli:Slin_3269)

Predicted SEED Role

"Ferredoxin, 2Fe-2S" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G3N4 at UniProt or InterPro

Protein Sequence (106 amino acids)

>Echvi_4682 Ferredoxin (Echinicola vietnamensis KMM 6221, DSM 17526)
MVTFEVEDHDGNRQPIEAPDDMGLSLMEVLKASEYPVLATCGGMALCATCHVEVLGGKDG
LGEATDVELDQLEALPEMYDTSRLACQIRISDELEGAVFKLRGEDQ