Protein Info for Echvi_4652 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Cellulase M and related proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF05343: Peptidase_M42" amino acids 45 to 335 (291 residues), 301.8 bits, see alignment E=6.9e-94

Best Hits

Swiss-Prot: 39% identical to YSDC_BACSU: Putative aminopeptidase YsdC (ysdC) from Bacillus subtilis (strain 168)

KEGG orthology group: K01179, endoglucanase [EC: 3.2.1.4] (inferred from 80% identity to mtt:Ftrac_1155)

Predicted SEED Role

"Deblocking aminopeptidase (EC 3.4.11.-)" in subsystem Protein degradation (EC 3.4.11.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.4, 3.4.11.-

Use Curated BLAST to search for 3.2.1.4 or 3.4.11.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G3K1 at UniProt or InterPro

Protein Sequence (350 amino acids)

>Echvi_4652 Cellulase M and related proteins (Echinicola vietnamensis KMM 6221, DSM 17526)
MNINTGLLKQICEVAGAPGFEKRIRELVIKEVTPLVDEVKVDNIGNVIAIKKGSKNPDGK
RVMVAAHMDEIGFIVTHIDDNGFLRFHTLGGFDPKTLTAQRVIVHGKKDLVGVMGSKPIH
VMTPEERNKLPKTTDYFIDLGMSKEEVEKYVQVGDSVTRDRELIEMGDCVNCKSIDNRVA
VFILIEALKAIENPPYDVYATFTVQEEVGLRGANVAAHGVNPDFGIALDTTIAFDVPGAS
PHEKVTELGKGTAIKVMDAMTICDYRMVDFMKKTADGHQIKWQPEILTAGGTDTAGVQRM
GKQGAIAGAISIPTRHMHQVIEMAHKHDIAASIKLLNACLENLDQYDWKH