Protein Info for Echvi_4646 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: SusD family.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF14322: SusD-like_3" amino acids 85 to 224 (140 residues), 73.7 bits, see alignment E=2.6e-24 PF07980: SusD_RagB" amino acids 264 to 505 (242 residues), 112.6 bits, see alignment E=2.9e-36

Best Hits

KEGG orthology group: None (inferred from 48% identity to hhy:Halhy_4822)

Predicted SEED Role

"RagB/SusD domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G683 at UniProt or InterPro

Protein Sequence (506 amino acids)

>Echvi_4646 SusD family. (Echinicola vietnamensis KMM 6221, DSM 17526)
MRLKPYILIVLLMAWAQSCNEEKLNPVNPNELSTETFYKTGPQYVAAVNAAYAALQANDL
YNREYFFIQDLLSDDVASGGAQLEAHRARVLNHVFDGSNSLVLANWRGWYRVIQRANLVI
ANVDQPQEDISENLRDRVLGEAYFLRGLAYYELSTLWGGVPLMTVSATGPDGAPRASQED
SYQQVIDDLTAAIGLLPPKSTYSGADVGRASIGAAQAVLAKLHLFRGDFAAAKPLLQAII
DSGEYRLVDRYLDNFEEENENNAESLWEVQFSEDFGTDGGWNADGNGIAEVTFRGQEYGP
TAWRNIIPNPTLVAEFEQESNGAEKDDPRYGYTLYSLGDTFNNGESVLSEDNVQGNTSVP
SWRKYQMIYKREAENTQSGINFRVIRYADVLLMMAEVENETSGPASALPYINQVRARADV
AMPPYPTAQYPTGTQEEMRRAIQHERRVELAGEQIRNRDIRRWRRMGYLENEPIPVYSDR
YDLLPIPLSEIDNNSALTNEDQNPGF