Protein Info for Echvi_4633 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: trigger factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 PF05697: Trigger_N" amino acids 1 to 149 (149 residues), 110.1 bits, see alignment E=1.7e-35 TIGR00115: trigger factor" amino acids 12 to 420 (409 residues), 185.7 bits, see alignment E=6.7e-59 PF28537: FKBP-like_TF" amino acids 156 to 248 (93 residues), 80.3 bits, see alignment E=1.6e-26 PF28539: TF_C" amino acids 296 to 439 (144 residues), 95.6 bits, see alignment E=5.4e-31

Best Hits

KEGG orthology group: K03545, trigger factor (inferred from 48% identity to mtt:Ftrac_1137)

Predicted SEED Role

"Cell division trigger factor (EC 5.2.1.8)" in subsystem Bacterial Cell Division (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G710 at UniProt or InterPro

Protein Sequence (442 amino acids)

>Echvi_4633 trigger factor (Echinicola vietnamensis KMM 6221, DSM 17526)
MEIKLDKQSANQASIKINLNEADYQPKVDAKIKDYAKKANIKGFRPGKAPIGMVKKMYGT
SVLVEEINDILSKSLSDYIKEQPFKLLGEPLPAVEDADAIDWKNQKEFEFEYKIGFVENV
DVTLDKSIKATDYKLKVDKKAIDDAIANLRSQYGKMTNPEVSQENDFLYGDLKAADGSFE
QALSLPLSKFDGRSVKKFIGVEKGAEIEFDPSKAIKSDLAEVLGVSQEEAEKVSGNYTFT
VQNINRTEDADMDQEFFDKVFGPDQVKTEEEFVAKIEEILGDNYNKETKVFTEEKIKEAL
TEKANIELPEAFLKEWLIKANEGKVSQEDVEKEFPIYAKQLTWSLISNKIAEDNEIKAEH
EDVIAKTQEMVREQLAASGLGSQMEDNMDMFVNNYLQGNEGQNYMQMLTAVQNDKVLDLV
KEKITLKEEKIDVEKFKELVQN