Protein Info for Echvi_4609 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: dihydrolipoamide dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 TIGR01350: dihydrolipoyl dehydrogenase" amino acids 5 to 464 (460 residues), 573.8 bits, see alignment E=1.2e-176 PF07992: Pyr_redox_2" amino acids 6 to 326 (321 residues), 240.3 bits, see alignment E=1.7e-74 PF00890: FAD_binding_2" amino acids 7 to 46 (40 residues), 30 bits, see alignment 1.8e-10 PF01134: GIDA" amino acids 7 to 94 (88 residues), 23.4 bits, see alignment E=1.6e-08 PF13738: Pyr_redox_3" amino acids 131 to 310 (180 residues), 46.1 bits, see alignment E=2.2e-15 PF00070: Pyr_redox" amino acids 176 to 255 (80 residues), 78.8 bits, see alignment E=1.9e-25 PF02852: Pyr_redox_dim" amino acids 346 to 455 (110 residues), 129.4 bits, see alignment E=3.8e-41

Best Hits

Swiss-Prot: 44% identical to DLDH_PEA: Dihydrolipoyl dehydrogenase, mitochondrial (LPD) from Pisum sativum

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 82% identity to mtt:Ftrac_3319)

MetaCyc: 44% identical to glycine cleavage system L protein 1 (Arabidopsis thaliana col)
GCVMULTI-RXN [EC: 1.4.1.27]

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of branched-chain alpha-keto acid dehydrogenase (EC 1.8.1.4) / Dihydrolipoamide dehydrogenase (EC 1.8.1.4)" in subsystem Glycine cleavage system or Leucine Degradation and HMG-CoA Metabolism or Photorespiration (oxidative C2 cycle) or TCA Cycle or Isoleucine degradation or Valine degradation (EC 1.8.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.4.1.27 or 1.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G6Z4 at UniProt or InterPro

Protein Sequence (465 amino acids)

>Echvi_4609 dihydrolipoamide dehydrogenase (Echinicola vietnamensis KMM 6221, DSM 17526)
MSSTKFDVIVVGSGPGGYVAAIRASQLGLKTAVVEAAELGGICLNWGCIPTKALLKSAQV
FEYINHAKDYGITVKDPKADFGGMVKRSRGVADGMSKGIQFLLKKNKIEQLLGWGKVKPG
KKVEVEDKDGKKTTYSADNIIIATGARSRELPAIKIDDKKIIGYRKAMTLEKQPKKMVVV
GSGAIGVEFAYFYAAIGTEVTVVEFMDRIVPNEDAEVSKALERMYKKAGMNIMTSTEVTS
VDTKGSGCKVTVKTKKGEETIDCDVVLSAAGVVANVENCGLEDVGIVVDKGRIKVDEFYK
TNMPGYYAIGDVIPGPALAHVASAEGIICVEKIAGHDPEPLDYNNIPGCTYCVPEIASVG
YTEEKAKEAGYELKVGKFPFSASGKAKAAGASDGFVKLIFDAKYGELLGAHMIGANVTEM
IAEIVAVRKLETTGHELIKTVHPHPTMSEAVMEAAAAAYDEVIHL