Protein Info for Echvi_4604 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Threonine aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01212: Beta_elim_lyase
  • amino acids 4 to 288 (285 residues), 329.1 bits, E=2.4e-102
• PF00155: Aminotran_1_2
  • amino acids 39 to 300 (262 residues), 24.4 bits, E=1.6e-09

Best Hits

KEGG orthology group: K01620, threonine aldolase [EC: 4.1.2.5] (inferred from 62% identity to dfe:Dfer_4745)

Predicted SEED Role

"L-allo-threonine aldolase (EC 2.1.2.1)" in subsystem Threonine degradation (EC 2.1.2.1)

MetaCyc Pathways

• folate transformations III (E. coli) (8/9 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• glycine degradation (3/3 steps found)
• folate polyglutamylation (4/5 steps found)
• glycine biosynthesis I (1/1 steps found)
• glycine biosynthesis IV (1/1 steps found)
• folate transformations II (plants) (8/11 steps found)
• L-threonine degradation IV (1/2 steps found)
• glycine betaine degradation III (4/7 steps found)
• folate transformations I (8/13 steps found)
• glycine betaine degradation I (4/8 steps found)
• glycine betaine degradation II (mammalian) (1/4 steps found)
• superpathway of L-threonine metabolism (11/18 steps found)
• photorespiration I (4/9 steps found)
• photorespiration III (4/9 steps found)
• photorespiration II (4/10 steps found)
• formaldehyde assimilation I (serine pathway) (6/13 steps found)
• purine nucleobases degradation II (anaerobic) (9/24 steps found)

KEGG Metabolic Maps

• Cyanoamino acid metabolism
• Glycine, serine and threonine metabolism
• Methane metabolism
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.1

Use Curated BLAST to search for 2.1.2.1 or 4.1.2.5

Sequence Analysis Tools

See L0G6Z0 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Echvi_4604 Threonine aldolase (Echinicola vietnamensis KMM 6221, DSM 17526)
MTIDLRSDTVTKPTEGMLAAMWSAEVGDDVLGEDPTVRALEIRLAAMFGMEAGMFCPSGT
MSNQIAIKLHAGQHKEVICHKDSHIYLYEGGGIMANAMTSVRLLEGHYGKVSPEAVEAAI
QPDDVHAPMTTLVSLENTMNKGGGSVYRLEEVTAIQEVCQAHQLKLHLDGARIFNALVAS
GEKAADWGNVFDTISVCLSKGLGCPMGSVLIGDKATIHQARRIRKAMGGGMRQVGFVAAA
GIYAMEHHIGRLGEDHRRARQVADILREHPHVEEVFPVETNIVIVRLRDISPKEMLSKLN
DKGIKAVQFGQDMVRFVTHLDITDDHLQAMEKRLK