Protein Info for Echvi_4597 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ribose-phosphate pyrophosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 PF13793: Pribosyltran_N" amino acids 4 to 119 (116 residues), 144 bits, see alignment E=2.7e-46 TIGR01251: ribose-phosphate diphosphokinase" amino acids 5 to 308 (304 residues), 353.6 bits, see alignment E=3.8e-110 PF00156: Pribosyltran" amino acids 161 to 254 (94 residues), 63.3 bits, see alignment E=2.6e-21 PF14572: Pribosyl_synth" amino acids 197 to 308 (112 residues), 91.5 bits, see alignment E=1e-29

Best Hits

Swiss-Prot: 54% identical to KPRS_PORGI: Ribose-phosphate pyrophosphokinase (prs) from Porphyromonas gingivalis (strain ATCC BAA-308 / W83)

KEGG orthology group: K00948, ribose-phosphate pyrophosphokinase [EC: 2.7.6.1] (inferred from 67% identity to chu:CHU_2627)

MetaCyc: 50% identical to ribose-phosphate diphosphokinase (Escherichia coli K-12 substr. MG1655)
Ribose-phosphate diphosphokinase. [EC: 2.7.6.1]

Predicted SEED Role

"Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)" in subsystem De Novo Purine Biosynthesis or Pentose phosphate pathway (EC 2.7.6.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.6.1

Use Curated BLAST to search for 2.7.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G3E9 at UniProt or InterPro

Protein Sequence (309 amino acids)

>Echvi_4597 ribose-phosphate pyrophosphokinase (Echinicola vietnamensis KMM 6221, DSM 17526)
MPEVKLFAGTNTKKLADSIAGNYGQDLGAMTLSMFSDGEMSPSFDESVRGCHVFLIQSTN
PNADNLLELCLMIDAAKRASAYKVCAVVPYYGYARQDRKDRPRVSIAAKLIANMIMSAGA
DRIMTCDLHAGQIQGFFDIPLDHLNGSAIFVPYLKSLDLGDNLIFASPDVGGVSRARAYA
KHFEVDMVVCDKHRKRANEVASMQVIGDVEGKDVVLVDDLVDTAGTMCKAAEILLDKGAN
SVRAIATHGVLSGKAYENIENSKLSELVITDTIPIKKESSKIKVLTVAELFAKAIHAVTG
NDSISALFI