Protein Info for Echvi_4589 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: MoxR-like ATPases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 PF20030: bpMoxR" amino acids 2 to 190 (189 residues), 53.5 bits, see alignment E=4.2e-18 PF07728: AAA_5" amino acids 24 to 153 (130 residues), 47.8 bits, see alignment E=3.8e-16 PF07726: AAA_3" amino acids 25 to 155 (131 residues), 208.2 bits, see alignment E=8.9e-66 PF17863: AAA_lid_2" amino acids 235 to 299 (65 residues), 71.4 bits, see alignment E=1.1e-23

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 66% identity to rlg:Rleg_5141)

Predicted SEED Role

"MoxR-like ATPase in aerotolerance operon"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G6X6 at UniProt or InterPro

Protein Sequence (308 amino acids)

>Echvi_4589 MoxR-like ATPases (Echinicola vietnamensis KMM 6221, DSM 17526)
MSAAIIGQDKLIERIILVLLADGNMLLEGLPGLAKTRAIKTLSKELDCGLSRIQFTPDLL
PSDITGTEIYQPELKEKFVFQQGPIFSNLILADEINRAPAKVQSALLEAMEERQVSVAGK
TYAMDPLFMVMATQNPVEQEGTYPLPEAQMDRFLMHVVIDYPDDASELAILRLNREEQQT
AKEEQKERLSPEVIFTARKEIAHVKISEPMEKYIVDLISATRYPEKYSEELDSWIDFGAS
PRGSIAMDRASRTHAWMEGRDHVTPEDVRAVVHDCLRHRLILSYEANAEGITADKVLEEV
ISKVAVVA