Protein Info for Echvi_4588 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF01882: DUF58" amino acids 59 to 271 (213 residues), 139.8 bits, see alignment E=8.3e-45

Best Hits

Predicted SEED Role

"hypothetical protein PA3071"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G7D1 at UniProt or InterPro

Protein Sequence (312 amino acids)

>Echvi_4588 Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) (Echinicola vietnamensis KMM 6221, DSM 17526)
MAKVREKYPAEVFTSLPELLRMEYVAHHFSLRARKQKVNTILAGKHASKLRGRGLDFEEV
RNYVKGDDIRNIDWKVTARTQRTHTRVFTEEKEKPALIVVDQSKSMFFGSQKRTKSVVAA
ELAAMLAFRVLKEGDRVGGVVFADEGTDIIFPKRDRKNILRFMEKIVSRNHELAHSNEFE
FDVALRDVIARIRNIVTHDFLVFFIGDFHRYSPQTIKYLKQIAQHNDVVVAKVYDPMERT
VPKAKFIAGNQDYQVSIDGQKSHVRKQFEEGFDADLMGFEATLKKHRIPVFSVDTVTPLE
SQIKAYFKKGKQ