Protein Info for Echvi_4586 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: von Willebrand factor type A domain.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 301 to 325 (25 residues), see Phobius details PF13519: VWA_2" amino acids 101 to 211 (111 residues), 55.7 bits, see alignment E=6.8e-19 PF00092: VWA" amino acids 105 to 279 (175 residues), 72.3 bits, see alignment E=6e-24

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 39% identity to caa:Caka_1695)

Predicted SEED Role

"BatA (Bacteroides aerotolerance operon)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G631 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Echvi_4586 von Willebrand factor type A domain. (Echinicola vietnamensis KMM 6221, DSM 17526)
MMPANFEIAYPWVFWLFPLPLLLFWLLPPLRMRSAALLFPGYQRALDYTGGKPRKSALVK
RRNFFNWLALILIWGLFLAALSSPQLVGEPKMKVKTSRNFLITADISFSMAQKDWEVDGQ
KVRRWDAVKSLMHEFIEKREGDRMGLVFFATNAYVQAPFTPDLQTVDQMLEEADVGMAGQ
MTHIGKAIAKGIDMFDQDTIKTKVMLLLTDGVDAGTDVLPLDGADMAKQDSVMIYTIGIG
DPGSQSSDLDEKTLQQIAEMTGGKYFLAKDAEQLQQIYTEVDKLEPIEYEEEEHRPETLL
YMYPLAAALGLAFLANLVASLVGLLKKSRNREAYV