Protein Info for Echvi_4580 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 151 to 176 (26 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 15 to 61 (47 residues), 37.7 bits, see alignment 1.6e-13 amino acids 112 to 151 (40 residues), 28.5 bits, see alignment 1.1e-10 PF00924: MS_channel_2nd" amino acids 221 to 269 (49 residues), 21.1 bits, see alignment 2.7e-08

Best Hits

KEGG orthology group: None (inferred from 31% identity to hhy:Halhy_3089)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G628 at UniProt or InterPro

Protein Sequence (275 amino acids)

>Echvi_4580 Small-conductance mechanosensitive channel (Echinicola vietnamensis KMM 6221, DSM 17526)
MKDVFDNTDWSFYLVDNTLKQIGDFLPRLFVFIVLLVMAWLIMRGLLFLIKKLLKLSKID
DLAENLSESDLFNHIKIKPSAIIMAFAKFFFVLLIIIFGADFLQLHAVSDEISKFLGYIP
QVFVAIILFVLGVYLSIVVKKFIRELLRSFGWSGASVISNIVSYIILIIVSITALSQAGI
NTHVITDNLSLVLGAFLACFALAIGLGSREVVLRILYSFYSKKNYQIGQVIKFDNIEGEI
LAIDNISITLKTDSGKMIVPIKDLVDTKVKILSNE