Protein Info for Echvi_4574 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 PF00072: Response_reg" amino acids 9 to 114 (106 residues), 73.3 bits, see alignment E=5.2e-24 PF00158: Sigma54_activat" amino acids 149 to 315 (167 residues), 233 bits, see alignment E=5.1e-73 PF14532: Sigma54_activ_2" amino acids 150 to 320 (171 residues), 69.4 bits, see alignment E=1.2e-22 PF07724: AAA_2" amino acids 170 to 300 (131 residues), 28.1 bits, see alignment E=6e-10 PF07728: AAA_5" amino acids 173 to 291 (119 residues), 28.3 bits, see alignment E=4.7e-10 PF25601: AAA_lid_14" amino acids 321 to 393 (73 residues), 69.4 bits, see alignment E=5.8e-23

Best Hits

KEGG orthology group: None (inferred from 61% identity to sli:Slin_3143)

Predicted SEED Role

"Response regulator of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G5C0 at UniProt or InterPro

Protein Sequence (450 amino acids)

>Echvi_4574 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains (Echinicola vietnamensis KMM 6221, DSM 17526)
MEEKNGFQIFIVEDDPWYGQVLEYHLTLNPDYEVRLFESGQALLDHLFLKPDLVTLDFSL
PDMNGDELYHKIRSSHPELPVIVISSQENIGVAVKLLKMGVSDYLVKDDSTKDLLWNSVI
RIRENQHLREEVKTLKEALGQKFSFQNSIIGNSPVLQKVFTMMEKAIKTNINVSITGETG
TGKEVVAKAIHYNSDRKKNKFVAVNMGAIPHELIESELFGYEKGAFTGAVTRKIGKFEEA
SGGTIFLDEIAEMDLNNQSKLLRVLQEREVTRVGGNEKIKLDVRLIVATHQHLAEKVKAQ
EFREDLFFRIMGLPIDLPPLRERGNDIILLAKHFMDEFCKANKMPSITISNTAKDKLLKY
QYPGNVRELKAIIELAIVMSNERELMPEDISFNSIAKEDMFLLEQKTLKEHTRDIIKYYL
KKNENDVMNTAKQLDIGKSTIYKMLQEGEI