Protein Info for Echvi_4540 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: NPCBM-associated, NEW3 domain of alpha-galactosidase.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 256 to 276 (21 residues), see Phobius details PF10633: NPCBM_assoc" amino acids 163 to 237 (75 residues), 62.8 bits, see alignment E=2.8e-21

Best Hits

KEGG orthology group: None (inferred from 51% identity to cpi:Cpin_2550)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G5Y9 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Echvi_4540 NPCBM-associated, NEW3 domain of alpha-galactosidase. (Echinicola vietnamensis KMM 6221, DSM 17526)
MSVDSVNLERPFLGIHPFVVLLFLVFCLASPIASAQESTKAPSFSARLINMEAPVNETFR
YQATLKNGSSASRYTLDAKAPKGWRVKFKVSGKQVTSLQMDPEKSENISIEVHPAYGAKP
DQYDIPVYAVGEDSLSLNLEAVVEGSFALELTTPSGRLSGEVTEGKSKQVNLQVKNTGSL
ALEEISLSSRTPPKWEATFSPSTIERLAPGKSTDVVATITIPDKTLPGDYVTKFTAKASE
TSSDASYRMTVTTSLLSGWVGMLVILMAIGLVYLLIRKFGRR