Protein Info for Echvi_4534 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: RNA polymerase sigma-70 factor, Bacteroides expansion family 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 TIGR02985: RNA polymerase sigma-70 factor, Bacteroides expansion family 1" amino acids 18 to 175 (158 residues), 139.4 bits, see alignment E=1.2e-44 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 18 to 174 (157 residues), 70.9 bits, see alignment E=1e-23 PF04542: Sigma70_r2" amino acids 27 to 88 (62 residues), 36.7 bits, see alignment E=6e-13 PF08281: Sigma70_r4_2" amino acids 122 to 166 (45 residues), 35.9 bits, see alignment 9.4e-13

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 34% identity to dfe:Dfer_3706)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G588 at UniProt or InterPro

Protein Sequence (191 amino acids)

>Echvi_4534 RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (Echinicola vietnamensis KMM 6221, DSM 17526)
MSIDAADVLAKLRHGDSEAFNAVYALYWKKLYFHAYKRVGTAELAEDMVQDVFFQFWLKR
ASLVITKSIESYLMGMLKNKILMHFREKYAASEKYDELVRHLSVHDSDTERRIDYGDLLS
HVDELIERLPEQSKHVFRLSRKEFLSNMEIADRLQISVKTVEYHIHYSLTYLRDHCPDYV
LTMVFSSFLFA