Protein Info for Echvi_4519 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Arylsulfatase A and related enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00884: Sulfatase" amino acids 35 to 382 (348 residues), 194.5 bits, see alignment E=5.3e-61 PF02995: DUF229" amino acids 266 to 309 (44 residues), 25.1 bits, see alignment 1.4e-09 PF01663: Phosphodiest" amino acids 267 to 308 (42 residues), 26.2 bits, see alignment 1.2e-09 PF16347: SGSH_C" amino acids 340 to 481 (142 residues), 95.7 bits, see alignment E=6.2e-31

Best Hits

Predicted SEED Role

"Choline-sulfatase (EC 3.1.6.6)" in subsystem Choline Transport or Choline and Betaine Uptake and Betaine Biosynthesis (EC 3.1.6.6)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.1.6.6

Use Curated BLAST to search for 3.1.6.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G572 at UniProt or InterPro

Protein Sequence (496 amino acids)

>Echvi_4519 Arylsulfatase A and related enzymes (Echinicola vietnamensis KMM 6221, DSM 17526)
MIVFKNGLVVSLTISLWFICVSAYSNGSNGEIRKPNILFVLTDDQAYWTLRTSGNDQAYS
PNLDKLASEGAFFENAFVTTPVCSPSRATLITGQYASELGIPDFIPQPGHKLYQPGRATG
LDPANITFAEVLRDNGYRTGLIGKWHLGDWTESGMDKKFHPTNHGYGYFMGLTGGGESPV
DPNLEENGEIHQMKGLTVDILTNRALEFIDDHQNTPFLLSVHYRSPHSKWLPVADEDWAP
YENMEMRVPHPDYPDLDTERVKSRMKEYLASASGIDRNVGKLMKKLNELGLYENTIVIFT
SDHGYNMGHNGIEHKGNGYWITKGDHPATENLAKNSRPNLYDQSLHIPVLIRWPGAIQPD
LKIKKTFSNLDWFPTLLEMANIPVPEDKTLRGRSIVPVLKGELADDWENDLYTEYSMVNY
STAHMRSYRTKKWKLVKDFQDPRRDELYHLETDPDEKNNLIKEKRGEIRNIIKHLTYKIL
SKMEELNDPLLDSITK