Protein Info for Echvi_4499 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF02311: AraC_binding" amino acids 15 to 71 (57 residues), 35.9 bits, see alignment E=9e-13 PF12833: HTH_18" amino acids 197 to 275 (79 residues), 71.8 bits, see alignment E=7.3e-24 PF00165: HTH_AraC" amino acids 241 to 273 (33 residues), 38.2 bits, see alignment 1.8e-13

Best Hits

KEGG orthology group: None (inferred from 52% identity to fjo:Fjoh_0187)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G5U9 at UniProt or InterPro

Protein Sequence (279 amino acids)

>Echvi_4499 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain (Echinicola vietnamensis KMM 6221, DSM 17526)
MRKAQFEPLEIDDFETDVYPLPIHLHTYYELVYIKKGNGTHELNHNSFTYKTGDLFIISP
EDQHFFNIKKRTHFTFIKFTDSYFSGHKMHRPDALLLSSPEDIMRNKMLKEVKLQMDEPC
VSILRNTVENIVAYNCRKDIASSPLVYYQLLSIFGLIREAAQKLSIRIDKGHPGKEELIS
YIHKHIYEPELLTAQHIARHFHIAPGYFSAYFKRNFDMSYRDYINEYRAKLIEKRLSVPT
LTLKEIANEFGFSDASHLNKAFKKYKGVSPSAYKKSMGR