Protein Info for Echvi_4486 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Retron-type reverse transcriptase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 TIGR04416: group II intron reverse transcriptase/maturase" amino acids 26 to 386 (361 residues), 349.2 bits, see alignment E=1.3e-108 PF00078: RVT_1" amino acids 79 to 299 (221 residues), 111.4 bits, see alignment E=5.7e-36 PF08388: GIIM" amino acids 328 to 386 (59 residues), 25.1 bits, see alignment E=1.4e-09

Best Hits

KEGG orthology group: None (inferred from 45% identity to sur:STAUR_3100)

Predicted SEED Role

"Retron-type RNA-directed DNA polymerase (EC 2.7.7.49)" (EC 2.7.7.49)

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.49

Use Curated BLAST to search for 2.7.7.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>Echvi_4486 Retron-type reverse transcriptase (Echinicola vietnamensis KMM 6221, DSM 17526)
QITNRASKHKGEALTNLHQYIDVELLTSSYRQLNKTSSVGVDGESWNAYGLRLPDRLPEL
LRTVKSGEYKAPQIRRVYIPKGKTGKRPLGIPTIEDKVLQPSVRSVLEPIYEEDFKEFSY
GFRPNRSCHHAIEYMFEKVSYGRMRYIIDADIQDYFGSIDHGLLRVFLDRRVKDGVVRKM
LDKWLKAGILEDKQLHYPKGGTPQGGIVSPILSNIYLHYVLDEWFSDKIQPLLTGKSFMV
RYADDFVMGFEKGEDAKRVMAVLDKRFTKYGLRLHPEKTKVIDLNTNIRGERSFDFLGFA
HYMGKTRKGRLVLKRKTSSKKLVMAITKTGDWIKGNRHRKLKELICDLNVRLRGHYAYYG
VTFNVRSLNKYHRCVERLLHKWLNRRGGNEPLYLEKIV