Protein Info for Echvi_4483 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Copper chaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 16 to 46 (31 residues), see Phobius details amino acids 52 to 69 (18 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details PF02411: MerT" amino acids 8 to 114 (107 residues), 48.2 bits, see alignment E=1.1e-16 PF00403: HMA" amino acids 142 to 203 (62 residues), 47.5 bits, see alignment E=2e-16

Best Hits

KEGG orthology group: None (inferred from 84% identity to mtt:Ftrac_2121)

Predicted SEED Role

"FIG00553203: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G6N7 at UniProt or InterPro

Protein Sequence (217 amino acids)

>Echvi_4483 Copper chaperone (Echinicola vietnamensis KMM 6221, DSM 17526)
MSNSNQSNTSSKSIGAGLLVAFTASLCCITPVFATLAGIGGIASAFSWMEPFRPYLIGLT
VLVLGFAWYQKLRPRTQEEIDCACDENERPSFWQSKKFLGIVTVFAVLMLAFPSYSGIFF
PDNSKADKVIVVKEDDILNTELRVKGMTCTGCEHSVNAALNNSEGVLEASSSYKSGIATV
KFDQTKVSIDQLADTVEEATGYKVTEKKIIQEKTLNQ